PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_016643-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 1572aa    MW: 170407 Da    PI: 5.9737
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_016643-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.32e-09815856346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT+eE e++ d    +G++ +++Ia+ +  +++  +c+++++k
  AHYPO_016643-RA 815 PWTAEEKEIFMDKLSIHGKD-FRKIASFLD-HKSTAECIDFYYK 856
                      8*****************99.*********.***********98 PP

2Myb_DNA-binding29.51.8e-0910211060445
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                       WT +E  l+v+a+  +G++ ++ I+r++g ++++ qck ++ 
  AHYPO_016643-RA 1021 WTDDEKSLFVRAFSSHGKD-FSIISRYVG-TKSRDQCKVFFS 1060
                       *****************99.*********.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.23E-14799860IPR009057Homeodomain-like
PROSITE profilePS5129316.027811862IPR017884SANT domain
SMARTSM007178.0E-9812860IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-5814857IPR009057Homeodomain-like
PfamPF002496.3E-7814856IPR001005SANT/Myb domain
PROSITE profilePS5129312.78510161067IPR017884SANT domain
SMARTSM007171.6E-710171065IPR001005SANT/Myb domain
SuperFamilySSF466895.46E-1010191067IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-410201061IPR009057Homeodomain-like
PfamPF002499.0E-810211060IPR001005SANT/Myb domain
CDDcd001673.23E-610211059No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1572 aa     Download sequence    Send to blast
MPPEPLPWDR KELFRDRDKE RGSSSSSSSR WRDSSSYVGS RNFNNNNHNS DFSPRWGFPS  60
SDFRRPPGHV KQGGWHMYPE DHGYSTPRSG ERFMDDDVFR PSGMRGDGRY GRPHSTNDQR  120
IVGDTPNQQH NSPANGVGRP HVTSDQRLVG NSPNHQHTSP ANRVGRPHIT NDQRLVGESP  180
KRAAHPNSDP CGQILAKDQV DRSSDVNGSG VGQKVDKENL VGTYEWNSLK WSRSRSLTSR  240
GSGFSHSSSS KSIGGESNDV KGELPPKNSA PVQSPSGDGV PCVAAVAPSE EASSRKKPRL  300
GWGEGLAKYE KKKVDGPEDS VNKAGNAMSV SNVEPSHSLT SNPFDKSPKV TGFSDCSSPV  360
TPSSFACSSS PGLEDKTFGK SVDVEGDTSN FSVSSMPVPE SQPEGSHFSL EKLDLNSITT  420
LGSMLTELLQ ADDQCSMDSG FMRSLASNKL LLWKGDISKA LEVTETEIDS LEKELTSLKA  480
DTIRSFHCPA SSNSGPADCK DGQSDGLNVF PRPHPLEVVT NGDIVMEDKF PCDDARGVNV  540
DSRHEDIDSP GTATSKFVDP PVQISPQECK SSSGETDSDE STKRAMEILG THNDETNVGT  600
SCQSHDRNLV LFDISTVCMD HPNAFAKKED NLFDTISACN KESADRAAKL LPSCDYSMEA  660
SRIYCLPAEP IVQEKFLRRK QSLRFKERVL ALKFKTFHHL WTEDLRLLSL RSHRSKPPKK  720
QDLSSRTLQI GSHKHRSSIR SRLASPGSSS LVPTTEIINF TSNLLSDSQV KVYRSSLKMP  780
AMILDEKERM TRFVSTNGLV EDPCAIEKER SLINPWTAEE KEIFMDKLSI HGKDFRKIAS  840
FLDHKSTAEC IDFYYKNHKS ECFEKIKKKK LEKPLSASTY MVTSGKKWSL EMNAASLDIL  900
GAAAAQADQA LETSKMLLGK SSSRKSRGSE AIIEASNSFC GPEDERETAA ADVLAGICGS  960
LSSEAMSSCI TSSVDPADGN QDWKQQKVGS AIRRPLTPEV TQNVDDSCSD ESCGEMDPAD  1020
WTDDEKSLFV RAFSSHGKDF SIISRYVGTK SRDQCKVFFS KARKCLGLDT FQTGSGHGGT  1080
NASNGTNGGG SDTEDAGIVE MGSVVCSDKS GSRMDEDLLH VNQDVSKPDA GPELNMVEDD  1140
CGPEQFDHKD AVMEIESLLP NANLDVSDPV DSSGVVDDPD KDSATAAVRT DIDAKAKMDA  1200
TIGNRSADDV APRNPGVMDV EAAPGISDIK SEARLFSAPV ELARPSTSEN NADRVPSGAP  1260
PCKSKGFPLD LSIKANLHDV VTHTVGSESI IGHPFQDSFL RKCNRTASHN SIPELALVQQ  1320
NESDLGSSCS SKVEKPACRN GDVKLFGKIL SKTSSIDKEN SNEKPKHHPF SGGKSSANQD  1380
SKGNPSCFAD DHNSFLGLEN VPIRSYGFWD GTKIQTGLPS FPDSALLLAK YPAAFANYSI  1440
SSPKSDQQPL QVTTMSGGNE CNMNGACVFS PREFSNGNGG VIDYAVLRNQ EGLQPFRLEE  1500
PRNSFEPISG LPQKGKGLVK LNVVQGVGGS CTGITDPVAA LKLHYASQQF GGSGGMIREE  1560
TWRSQGGDVG R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C4e-18779864994NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D4e-18779864994NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010669645.10.0PREDICTED: uncharacterized protein LOC104886820
TrEMBLA0A0K9QWA80.0A0A0K9QWA8_SPIOL; Uncharacterized protein
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.18e-85MYB family protein